SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015UYU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015UYU8
Domain Number 1 Region: 10-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000811
Family SMI1/KNR4-like 0.017
Further Details:      
 
Domain Number 2 Region: 168-220
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000131
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015UYU8
Sequence length 231
Comment (tr|A0A015UYU8|A0A015UYU8_BACFG) SMI1 / KNR4 family protein {ECO:0000313|EMBL:EXY88136.1} KW=Complete proteome OX=1339316 OS=Bacteroides fragilis str. 3998T(B)3. GN=M125_5233 OC=Bacteroides.
Sequence
MKIELENCQKSLTLKDFEEVESKLGHVLPERLKEFYLQYNGGEPKQQTISINKYYEVEIR
IFQPFKYNKSFKNALFHTVEGETLEHRSSNSISDNILLFASGHNNLRNIGVIAINIKNRA
VYFYKIIGFVKNSDAFIFDEPQLIADSIDDFFNNLVAFPKIEEEQQTEIIEIEGVMPELS
DCSASLTKEDIKNFEVELNVKIPAGMKNFYLKFNGGMPSPYCFQPQDEDLD
Download sequence
Identical sequences A0A015UYU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]