SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015VC39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015VC39
Domain Number - Region: 72-105
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0388
Family Cell wall binding repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015VC39
Sequence length 106
Comment (tr|A0A015VC39|A0A015VC39_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY92916.1} KW=Complete proteome OX=1339316 OS=Bacteroides fragilis str. 3998T(B)3. GN=M125_0147 OC=Bacteroides.
Sequence
MNNAKIYIESNSVKLSEHSGDYEAVSKYHALKALEMQEQNYAWHDLTVNPDDLPEHREIV
IVKMKFDMYHYAIGTYSQIDGKWYLREDDEFYQTDKEVTKWQKIND
Download sequence
Identical sequences A0A015VC39 E4VUJ9
WP_005776937.1.53885 WP_005776937.1.7590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]