SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015VTC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015VTC7
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A015VTC7
Sequence length 115
Comment (tr|A0A015VTC7|A0A015VTC7_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXY71530.1} KW=Complete proteome OX=1339287 OS=Bacteroides fragilis str. 3986 T(B)9. GN=M083_0773 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWMTFQVENFMEWRPIV
Download sequence
Identical sequences A0A015VTC7 F7LL23
WP_008658588.1.40326 WP_008658588.1.40404 WP_008658588.1.51763 WP_008658588.1.75176 WP_008658588.1.77492 WP_008658588.1.89424 WP_008658588.1.93759 WP_008658588.1.97365 WP_008658588.1.98903 WP_008658588.1.9932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]