SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015WXI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015WXI3
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.07e-36
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 283-366
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.54e-22
Family HSP40/DnaJ peptide-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 152-231
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.49e-19
Family DnaJ/Hsp40 cysteine-rich domain 0.00027
Further Details:      
 
Domain Number 4 Region: 131-156,236-279
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000051
Family HSP40/DnaJ peptide-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015WXI3
Sequence length 394
Comment (tr|A0A015WXI3|A0A015WXI3_BACFG) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} KW=Complete proteome OX=1339283 OS=Bacteroides fragilis str. 3996 N(B) 6. GN=M079_1762 OC=Bacteroides.
Sequence
MAEKRDYYEVLEVTKESTVEEIKKAYRKKAIQYHPDKNPGDKEAEEKFKEAAEAYDVLSN
PDKRARYDQFGHAGMSGAAGNGGPFGGFSGGMSMDDIFSMFGDIFGGHSGGGFGGGFGGF
GGFGGGGSQQRKFRGSDLRVKVKLNLKEISTGVEKKFKLKKYVPCSHCHGTGAEGNSGSE
TCPTCKGSGSVIRNQQTILGTMQTRTTCPTCNGEGKIIKDKCKVCGGEGIEYGEEVVTVK
IPAGVAEGMQLSMGGKGNAGKHNGISGDLLILVEEEPHPELIRDENDLVYNLLLSFPTAA
IGGAVEIPTIDGKVKVKIEAGTQPGKVLRLRGKGLPSVNGYGTGDLLVNVSVYVPETLSK
EEKSTLEKLEESKNFKPSTSIKEKIFKKFRSLFD
Download sequence
Identical sequences A0A015U2Y7 A0A015WXI3 D1JL33
WP_008768333.1.21908 WP_008768333.1.26260 WP_008768333.1.30158 WP_008768333.1.37052 WP_008768333.1.38746 WP_008768333.1.53885 WP_008768333.1.55270 WP_008768333.1.56204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]