SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015XA56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015XA56
Domain Number 1 Region: 77-138
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000316
Family SPT5 KOW domain-like 0.063
Further Details:      
 
Weak hits

Sequence:  A0A015XA56
Domain Number - Region: 4-85
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000235
Family N-utilization substance G protein NusG, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015XA56
Sequence length 155
Comment (tr|A0A015XA56|A0A015XA56_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ30985.1} KW=Complete proteome OX=1339327 OS=Bacteroides fragilis str. S36L11. GN=M136_5252 OC=Bacteroides.
Sequence
MKKDKIETYTPCEETLMERNGIKKKLRRPVINSLMFFRSTVCRALEVQRQFTNKVILYTR
QKGLKRLPLAIPDREMNIFMLVTSSGEQGMEYFGEDNSKFQQGERVRVIDGKFKGAEGVI
CRIRKNRRLVVTVQGVCAVATSYIPQAFLQRIGQD
Download sequence
Identical sequences A0A015XA56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]