SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015Y4D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015Y4D7
Domain Number - Region: 4-53
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0124
Family Regulator of G-protein signaling, RGS 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015Y4D7
Sequence length 60
Comment (tr|A0A015Y4D7|A0A015Y4D7_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ26807.1} KW=Complete proteome OX=1339327 OS=Bacteroides fragilis str. S36L11. GN=M136_4044 OC=Bacteroides.
Sequence
MEISFVAFSERQPAKNVQLFNIYCKNNCFIMRNSKNIFKFAADIISRYLRSNGQAKWIRN
Download sequence
Identical sequences A0A015UFR4 A0A015V7K4 A0A015Y4D7 A0A017N2V1 A0A0E2TF10 A0A1C0WS78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]