SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015YE31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A015YE31
Domain Number - Region: 58-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.02
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015YE31
Sequence length 115
Comment (tr|A0A015YE31|A0A015YE31_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ30172.1} KW=Complete proteome OX=1339327 OS=Bacteroides fragilis str. S36L11. GN=M136_0709 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFHKKYDPAEVEGAVVCWNVDEQRWTTFQVENFMEWRPVV
Download sequence
Identical sequences A0A015YE31 A0A017PAV1
WP_032556203.1.15557 WP_032556203.1.2011 WP_032556203.1.30608 WP_032556203.1.4066 WP_032556203.1.43770 WP_032556203.1.65409 WP_032556203.1.65726 WP_032556203.1.75668 WP_032556203.1.91849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]