SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015ZC68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015ZC68
Domain Number 1 Region: 179-327
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000118
Family SMI1/KNR4-like 0.016
Further Details:      
 
Domain Number 2 Region: 3-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000111
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A015ZC68
Sequence length 329
Comment (tr|A0A015ZC68|A0A015ZC68_BACFG) SMI1 / KNR4 family protein {ECO:0000313|EMBL:EXZ41942.1} KW=Complete proteome OX=1339280 OS=Bacteroides fragilis str. 2-F-2 #4. GN=M076_4943 OC=Bacteroides.
Sequence
MELNKIKDSLIHIDKQLSEDDWKEVEQKLYCTIPSCVKNFYNTVNGGLTIGNLFLLNGDE
QITIKKFMPIKYNADFHNAPESTMEGMTLIQRSHQTIGSHELIIGITAGRPNRICVNVKT
GVVELYPLIGLNKDAFIFDPPIFISSSFDQFLSMLKYEPKESDDNLIRKERTSKEKLKIE
TSAKKLSSEDWLEFEKNTKFKLPTTMKNFYLKNNGGMPNLNFFSPQDEDMDEVEINIFLP
IKYPLKGIQTIEETSRSLWERNMISKSFLPFAIDSGNNLYAIHNKTLCIYYIVMDIWHNE
WSCEENFKANSTKIASSFRYFITHLIPEE
Download sequence
Identical sequences A0A015ZC68 C6ZBZ9 K5ZRK7 S3YQP8
WP_008669248.1.10040 WP_008669248.1.29417 WP_008669248.1.33107 WP_008669248.1.34613 WP_008669248.1.53995 WP_008669248.1.56575 WP_008669248.1.8648 WP_008669248.1.97349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]