SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016AEL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016AEL9
Domain Number - Region: 53-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00184
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016AEL9
Sequence length 115
Comment (tr|A0A016AEL9|A0A016AEL9_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ26896.1} KW=Complete proteome OX=1339327 OS=Bacteroides fragilis str. S36L11. GN=M136_3884 OC=Bacteroides.
Sequence
MKQKKRPASQTEAMKLRWKKRIVFEKGYTEMCAKWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYDPTQIEGAVVYWNVDEQRWTTFQMENFMEWRPIV
Download sequence
Identical sequences A0A016AEL9 A0A016FS63 A0A017N7N2
WP_032557412.1.2011 WP_032557412.1.30608 WP_032557412.1.4066 WP_032557412.1.43770 WP_032557412.1.65409 WP_032557412.1.65726 WP_032557412.1.75668 WP_032557412.1.91849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]