SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016E3E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016E3E5
Domain Number - Region: 39-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00129
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016E3E5
Sequence length 102
Comment (tr|A0A016E3E5|A0A016E3E5_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ71646.1} KW=Complete proteome OX=1339314 OS=Bacteroides fragilis str. 3976T8. GN=M123_4006 OC=Bacteroides.
Sequence
MKLRWKKRIVFEKGYTEMCAEWMAERLEALTDHLQYGHAAIAYQKQNGDFRLVKATLIYY
EAEFHKKYDPTKIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A016E3E5 A0A016JEN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]