SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016FQW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016FQW0
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0018
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016FQW0
Sequence length 115
Comment (tr|A0A016FQW0|A0A016FQW0_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ91796.1} KW=Complete proteome OX=1339269 OS=Bacteroides fragilis str. Korea 419. GN=M065_5846 OC=Bacteroides.
Sequence
MKRKKRPASQSEAMKLRWKRRIVFEKGYTVQCAEWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYDPTQIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A016FQW0 Q5LF47
272559.BF1546 gi|60681047|ref|YP_211191.1| WP_010992556.1.22050 WP_010992556.1.37988 WP_010992556.1.58084 WP_010992556.1.65921 WP_010992556.1.97964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]