SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016HUW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016HUW0
Domain Number 1 Region: 139-214
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000468
Family Crystallins/Ca-binding development proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016HUW0
Sequence length 265
Comment (tr|A0A016HUW0|A0A016HUW0_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EYA17447.1} KW=Complete proteome OX=1339337 OS=Bacteroides fragilis str. 1007-1-F #3. GN=M146_4353 OC=Bacteroides.
Sequence
MASCANDLDGFISIPDNATGVQQISTRSSSDNLRIVYHGKVYETLYTIIDDSIYSYQNSE
VKDLMDNLSETRPNLRTFIHGNGVIEYFDDENDFNLNKERIMSEYEKESLSTSLSERWFP
TDNVPQLAPIDPENNEVEIYLYEDPYYLGDLFSLQRSRSDSDYNELSKVWNFGGQISSMI
VHTIGFGGVFTFYERMGCQGKGITLVLTAGQYINLCSELSADAMRGISYGSIAMSDLRSL
HWSGIAGNWNNRICCIKVDRYIGMM
Download sequence
Identical sequences A0A015QKQ8 A0A015ZME8 A0A016HUW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]