SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016JEG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016JEG3
Domain Number - Region: 60-113
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0432
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016JEG3
Sequence length 242
Comment (tr|A0A016JEG3|A0A016JEG3_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EYA36697.1} KW=Complete proteome OX=1339279 OS=Bacteroides fragilis str. 20793-3. GN=M075_4815 OC=Bacteroides.
Sequence
MDERYVALCGITEEEIRTNLDQELYELADRQRMGYEEVCRELKACYDGYHFVEDSIGIYN
PFSLLNTFYKMKFGNYWFETGTPTYLVELLQIHHYDLHKMAHVETDADVLNSIDSSSTDP
IPVIYQSGYLTIKGYDREFGIYRLGFPNREVEEGFMKFLLPYYADTNKVEAPFEIQKFVQ
EVRAGDYDSFFRRLQSFFADTPYEMIRDRELHYQNVLFIVFKLMGFYTQVEYHTAEGRVD
LV
Download sequence
Identical sequences A0A016JEG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]