SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016QNU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016QNU7
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.66e-33
Family N-utilization substance G protein NusG, N-terminal domain 0.00000866
Further Details:      
 
Domain Number 2 Region: 135-190
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.61e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016QNU7
Sequence length 190
Comment (tr|A0A016QNU7|A0A016QNU7_9DEIO) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1476583 OS=Deinococcus phoenicis. GN=DEIPH_ctg040orf0003 OC=Deinococcaceae; Deinococcus.
Sequence
MSIEWYAVHTYVGQEDRVEQHLLERARKLGMHHTKIFQVLQPTEEAVELREGGKKETVKR
KLFPGYVFVQMDVEDDDAPGELGESWEVVRGTNGVTGFVGTATRPVPLSPEEVQRLLASV
GVAAQPQEEAAPRVKVDLKPGDMVRVTGGPFADFSGVVSEINAPQAKVKVLVSIFGRETP
VELDFAQVSK
Download sequence
Identical sequences A0A016QNU7
WP_034358400.1.31558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]