SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016QRC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016QRC1
Domain Number - Region: 43-111
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.00102
Family Chlorophyll a-b binding protein 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016QRC1
Sequence length 141
Comment (tr|A0A016QRC1|A0A016QRC1_9DEIO) Uncharacterized protein {ECO:0000313|EMBL:EYB68685.1} KW=Complete proteome OX=1476583 OS=Deinococcus phoenicis. GN=DEIPH_ctg017orf0011 OC=Deinococcaceae; Deinococcus.
Sequence
MSDFDALQAVIRRHARERQAEGRACEAFLNALYHALRTASGPGRPLNNVILDPTPDPLCR
LRPPPPGGWYAAWLRLGLCEVLVRVRRVDGAFVGEYGPGGAFHLTHVTEDDLTALARRLL
RELEATYAGRDPGAHPELPLN
Download sequence
Identical sequences A0A016QRC1
WP_034354965.1.31558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]