SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016QSX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016QSX9
Domain Number - Region: 59-90
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016QSX9
Sequence length 103
Comment (tr|A0A016QSX9|A0A016QSX9_9DEIO) Uncharacterized protein {ECO:0000313|EMBL:EYB69081.1} KW=Complete proteome OX=1476583 OS=Deinococcus phoenicis. GN=DEIPH_ctg011orf0049 OC=Deinococcaceae; Deinococcus.
Sequence
MTTPLPLAALASRLRGFFVRPRPQPIPAPLPPLTWYILTHEFGGPEHVFACTPENVRLCL
ALLTDHGLSDVCRDALAEAIARRPEEPARYGDWWTLTSLKGEA
Download sequence
Identical sequences A0A016QSX9
WP_034353856.1.31558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]