SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016S1I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016S1I4
Domain Number 1 Region: 635-749
Classification Level Classification E-value
Superfamily PX domain 2.22e-18
Family PX domain 0.0044
Further Details:      
 
Domain Number 2 Region: 346-476
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000309
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016S1I4
Sequence length 905
Comment (tr|A0A016S1I4|A0A016S1I4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB84505.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0315g2272 OC=Ancylostoma.
Sequence
MASSGSLRILFCDPVDMFGIRVYLARSQPECRSRPRPEYSLLRRVLPIACCLFSLFMGVS
IATWIANDSNGRFLYPLVHAWFSKYYAGKEPHTAVSDEEQRSFSWKELKVPTSVNDAVES
LLDQLIDTYVNNWYESGISRDRDFLNEIRYQIRFACSQLISKAKALGLPAVVAEDVIPTA
ALHMHRIIKYEDDLSEKVYPRSRMETSICEAFSDLHFCLGSRQNELDYLRQVADFLTIKL
LDDTHLAGRAHDDDGPSGLGERANMSTWPSQSVRHFLRELIVNALLLPCLDLIADPDTIN
HLLIMTFDAQKGEGGGAEQLCDSNRRDVSFLGGFTENATQVVPDSLLHLKLSEVLRDARQ
YSTFRLYLQDTRGPVNELCFLAEASRIHDSMQRKAESSSQIAYDIWQLFGQFVHDSAPDR
IEFDPEIVQEFKAAVECNNLPLLEKVVETSYQIVYQRMQSDHVVPFCQSDSFLGYLCGSP
PVCVNELIDQRSMPRKASVSGGTFSFAQFRSRLRKAIAVVSLDGSLDSEESLDNNLVEED
DMISCESALPESGSDANLDRNDSASSLQSGSGSFSQLTLPSIDVSMTGDTGSISPASGYS
VTDEDDVSASASIIDCPSSEPAFVIDKETRNINLWKVNVSKIQPMRDNTTGRTIYVYVID
VERTEAKEKETKSWSICRRFSEFYVLEMKLLEFHGDSLRFTLLPPRKPLITRNRAFLEQH
RLLFSMFLSSLCKQKMLHRSDLLFAFLTSCEEFRSSLLLSDLNPWKVVKKMPSKLGREKG
QHLRPFLLTVLANTLYAQDKVDFKEKIETSDSSSLSSISMAADHYYTNYYNPLFGNNCYG
CNVAEEDSGTARIWTRSLTDSISLLFFSIMACTSQWILNIQSALRLVIIFKLHSTLDLCQ
RKLAA
Download sequence
Identical sequences A0A016S1I4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]