SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016S1M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016S1M4
Domain Number 1 Region: 50-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000536
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 98-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  A0A016S1M4
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000105
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016S1M4
Sequence length 154
Comment (tr|A0A016S1M4|A0A016S1M4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB84525.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0314g2213 OC=Ancylostoma.
Sequence
MEWTAWTVCTNKCDEESFRIRNRVCLYRGMAHTGCEGPAQDQSSCPTHTCPTWSDWGDWS
VCSATCGQGSQHRIRSCENGVDCPGSNRELRFCQLASCPYWDEWMTWSGCSVTCGIGICE
RRRRCVTDDLLNLPNSEELDDALFEVEAGPAGDC
Download sequence
Identical sequences A0A016S1M4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]