SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016S8W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016S8W7
Domain Number 1 Region: 46-176
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-43
Family Regulator of G-protein signaling, RGS 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016S8W7
Sequence length 190
Comment (tr|A0A016S8W7|A0A016S8W7_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:EPB80520.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_00417 OC=Ancylostoma.
Sequence
MMDIATSFHMLHDDSIEPHHSGPISKTISLIRNKLDVALSTSSLYPSRDEVRQWRHSFES
LLNHKYGCSLFREFLKKEFSDENVDFWLECEEFKKMKDGKKATIQKAHEIFKEYVAASAP
KEVNLDSDTRAATKAAMESGCKTDTFSLAQSRIEQLMAKDSYRRFLKDPLYLDLAEGLEN
GENSPKTFQK
Download sequence
Identical sequences A0A016S8W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]