SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016S922 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016S922
Domain Number 1 Region: 14-148
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-29
Family Astacin 0.0018
Further Details:      
 
Domain Number 2 Region: 204-278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000314
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016S922
Sequence length 310
Comment (tr|A0A016S922|A0A016S922_9BILA) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0273g978 OC=Ancylostoma.
Sequence
MVRSGRAGNEGLHVTALYDACASDVGKVGGWQYLYLGRYCEGFGGIAHELGHALGLVHTM
SRSDRDDYILVDLINMKPEYAEEFKKHSPVRSYGIGYEYGSIMHYGQRSVFLPQAYLIIP
FDSKYKNTLGSQMISFADLTLINRHYKCTEKCDSKSSAVCKNRGYPHPRDCSRCLCPSGY
GGKDCSERPSDGCGHELEASKTWQNVSITIRNDDPKQYLDGYKKCIYWIKSPEGTRMKIR
LETIRFQSTAGCSNDGIEIKAKKDITLTGYRFCYEEDEDLVLSPRFSTAPVIVYSRVNIT
STAIISYRYG
Download sequence
Identical sequences A0A016S922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]