SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016S973 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016S973
Domain Number - Region: 52-90
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.000418
Family N-terminal domain of cbl (N-cbl) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016S973
Sequence length 133
Comment (tr|A0A016S973|A0A016S973_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB87208.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0266g687 OC=Ancylostoma.
Sequence
MGKKWCLFVNIKRSPPWVDKDEQHEPQSKAGHHPLIVMISAWCDCKGIIHYQKLHDSRWE
VLTSPPYRPDLVPRDYQLLLTLSNALQRKARDDEDDLDRWLSNFFESVPAQFYADGIETL
PIKWQRVVVRGDD
Download sequence
Identical sequences A0A016S973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]