SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016SKY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016SKY9
Domain Number 1 Region: 375-503
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-36
Family Regulator of G-protein signaling, RGS 0.0000713
Further Details:      
 
Domain Number 2 Region: 22-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-28
Family DEP domain 0.018
Further Details:      
 
Domain Number 3 Region: 302-356
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000458
Family Transducin (heterotrimeric G protein), gamma chain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016SKY9
Sequence length 554
Comment (tr|A0A016SKY9|A0A016SKY9_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB90979.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0211g2173 OC=Ancylostoma.
Sequence
MALPRLRVNANSEEKLVHPNHMVYQKMEALVNHMLDAETGVPIKTVKSFLSKVPSVFTGQ
DLIAWIMKSLDMSDLSDALHLAHLIASHGYLFQIDDHVLTVKNDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKAHLELEDFEAENLAKLQKMFSRKWEFVFMQAEAQYKVDKK
RDRLERQILDSQERAFWDVHRPVPGCVNTTEVDFRKLSRSGRPKYSSGGHAALNAAASSG
CSPYSTSAAAAHASMPSTSNGAPATTQQTAQSSSGSSSGSGGSFRSNYYARPGLRRCTQV
QDTLKLEINQLNSRLSKNVLRTSKVVENYLAYYEHRKVFDPFLTPLGSVSDPFQSQPNPW
ISDTVDFWQHDKITGDISTRRLKLWEECFEELLADILGRETLQKFLDKEYSGENLRFWWE
VQKLRKCSCRMVPVLVTEIYNEFIDSNATSPVNVDCKVMEITEENLKNPNRWSFDEAADH
IFCLMKNDSYQRFLRSDIYKDLLIQSKKKRVSGPRAAGWLKRRGKIHTVFSCLNTLLHDN
TEGSEGFYQVHKRI
Download sequence
Identical sequences A0A016SKY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]