SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016SPA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016SPA9
Domain Number 1 Region: 116-237
Classification Level Classification E-value
Superfamily Cyclin-like 1.02e-17
Family Cyclin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016SPA9
Sequence length 254
Comment (tr|A0A016SPA9|A0A016SPA9_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB92149.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0197g1564 OC=Ancylostoma.
Sequence
MCISNNLLRNFADLVRCPSAVLLGNPPVRRKGGETPTSHHVLNYSLTGLTPIRDDSESRT
EVTVGDGDSYQLEGDDTNRNDYDPMMLDEIASASRTIIRTNGFIGVTKRFAPPQVAKATL
NETFAEKFPNIHLTYSKLRSIKRDLWLLAKECGVDEYTLAHTFVYFERIVCKGLISKYNR
KIVAGVAFLVAVKLNDYKKPVIVKVLECAEEQFRISRRELLSFELPLCSALQFDLFPPAH
HVEPHLRKIMFGVF
Download sequence
Identical sequences A0A016SPA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]