SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016T3Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016T3Y8
Domain Number 1 Region: 244-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 217-244
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000745
Family Somatomedin B domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016T3Y8
Sequence length 440
Comment (tr|A0A016T3Y8|A0A016T3Y8_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB97309.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0141g2201 OC=Ancylostoma.
Sequence
MLSLFLVLLSASPRAEAGCYQRRMCCAGRNVSCKAIDDGIRHLPTTMNPYRKADDAHRYH
HGAPKTGPFTTYQTPYYEASGDGYELVYPDVYEAEHNRRIGKVVFPDVIELDGSGAGDIY
LRYVPPSDDDLISNRVPKSNDIHQKTSPARKITHLLFGYPQGPDEPPEDIQRYTPKPKHL
LIRYSVLSQHIPLMVSTTPLPDYYDEEPQFMYLEAPPTDCYCDESCVALGDCCSDYTFVC
PRRDCAVSSWGPWEGCVADDGTCGIGVQQRTRYVRQKAERGGKECPPLKEMRTCYTQCPK
RRSLDDITTVALLLDYRHNQTRSKMARDNIYWDLPSVHEKLKEATNYCVKYKIGWVNRNC
WHKQFKTRLYRGNTICAECQPEATLHRSNSRCASDLEDGEQGFWKLIGPKSCNGMWTRIG
RDDNCHCSQKHPDLDPFLLV
Download sequence
Identical sequences A0A016T3Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]