SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016T3Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016T3Z9
Domain Number - Region: 48-108
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016T3Z9
Sequence length 233
Comment (tr|A0A016T3Z9|A0A016T3Z9_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYB97319.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0141g2203 OC=Ancylostoma.
Sequence
MLITTITLILHGFIPVCDDLLIEICRKRLERLGKKPVTREVSVDDMGVLQQKIAQIEKQM
RTVQSQLHVNTDIPLSSTAYVATRSAPTQAELIRQHQKEALRELEQQVAKYVDPAGEQHA
NTSKESVSCPDPMNLFRGLLMVNNAAGTANASKHSGDATKPTSFNSGLPSLGQQKSYPFD
NPLLKMEQMSRHPGCSGVCLGCMDDETQDRALLALTMLSEKWNAETDSDTDTE
Download sequence
Identical sequences A0A016T3Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]