SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016TBN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016TBN4
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016TBN4
Sequence length 187
Comment (tr|A0A016TBN4|A0A016TBN4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC00404.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0116g608 OC=Ancylostoma.
Sequence
MQPKKCFSYHCKAAPAPCGHPQPPCAPPPYVPPPPPPAPPPPPPPPPPPPPPPPPPPPPS
YPGPVYNTGGGPEFGGVEQPTPNFSGGTYGGTVDAMEPMRAFSAGRTNARGSRRPQMRES
QIHSAGIPVNRSNFGRNRNSQRNNSFGKRSVAGGKENRDDYLASRRSPSSAWYRRYSPAT
KTRKHSR
Download sequence
Identical sequences A0A016TBN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]