SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016TMP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016TMP8
Domain Number 1 Region: 271-406
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.93e-37
Family Regulator of G-protein signaling, RGS 0.0000265
Further Details:      
 
Domain Number 2 Region: 7-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000218
Family DEP domain 0.019
Further Details:      
 
Domain Number 3 Region: 205-261
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000102
Family Transducin (heterotrimeric G protein), gamma chain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016TMP8
Sequence length 505
Comment (tr|A0A016TMP8|A0A016TMP8_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC03808.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0091g2438 OC=Ancylostoma.
Sequence
MSCTIPLAKLDTLSRRLQESVQLRTHKYFRVAVPQALTGQSLVALVGEKGYAEDEAEAVH
LATLLLQHGYLFPVIEPALTVRDDGTLYRLQRPYFWPSHATQTDNVEYAIYLNKRLLRNE
QKHGLEEDEAESYNRFAELLGHMWGFITQQAEMQLKQQKEKKKADKVVYDSEERAFWRLR
RPCHPDFLEQHVQKVDRRLRKATAQGYRNLVERLKFSLKTKPWLKALKASDTMVQWVDER
VDYDPFLTVPQPSNPWITDDTNLWTLNTDTVEVPTERRVKRWGLSVQELVKDPIGRQVLE
TFLESEFSSENIRFWIAIQDLKYSPNDQIDHKTERIYEEFLAPGAPAQVNVDSRTLDQTL
DCLQKATTASTRRHAFTHSEEHVFTLMAKDSYPRFVRSQIYKGVLSAAQQQGSRRLGWRN
FIFNMGAAKKPQCKPAKTRDELHSQNLPKQLSSDSLPVRTAHAVSKQGCLLSLLCNKVGH
EVLPQNLFFDPEFLGLNLEFLSYRM
Download sequence
Identical sequences A0A016TMP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]