SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016U761 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016U761
Domain Number 1 Region: 19-64
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016U761
Sequence length 404
Comment (tr|A0A016U761|A0A016U761_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC10682.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0054g2494 OC=Ancylostoma.
Sequence
MRLCFLYLTQLWSLASALGWAGWSPWTPCSRTCGGGVSQQLRRCLDIKCSGHSVRFRVCN
EKECDTLHRTSRETICGGEEILSKQQCEVVCKSRTSGSHFLWRMADGAPCQADSNRAVCS
HGTCQVVGCDDVIGSSLRFDVCGVCGGRGDSCDSAQFVWKESGEFTECPSSCTQAARDFH
EGKDDDVRESRAIVVCINANTGRVVPERLCADRKRPPAKTKPCPLLICPSRLLLNRAANG
EMENMVFSDEKIFTVEQVLNKQKDRLWLKGKNSVSPSLFSVTRKQGPLSIMVWARITQSG
RTPLVFLEKGSKMNAKMYRSLVLETHLKPCAKKHFRNARWIFQQDSAPCHTALSTQGWLR
DNVPDFISPTQLLAGSPYLYPMDFRIWSILESEAVLHRHRALQF
Download sequence
Identical sequences A0A016U761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]