SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016UD28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016UD28
Domain Number - Region: 195-222
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.00667
Family Rabenosyn-5 Rab-binding domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016UD28
Sequence length 250
Comment (tr|A0A016UD28|A0A016UD28_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC13234.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0044g1049 OC=Ancylostoma.
Sequence
MPGFAREFYYPRLFILAPIRLCVGHLLVVTMKSQDVSSLNLLPTTFSTSSFTDSCAPLAY
PNLPPQQIMPLNFLLNPSLFSSFMPSLPGSVVNGLPISTLHLSLGSQQPSTSLSQIPHLF
EQSTEGCSQSSECSQATESGMSSPRNHSPVRVSSVESCSTTTRIRRGRPQQEISDEDDPS
SQKRRHRRLYARQYRAQMRHKVDEVKVLSARLEEMQRTIERLEAALESERREHHHKTVLL
NSMIQSKLLP
Download sequence
Identical sequences A0A016UD28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]