SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016V203 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016V203
Domain Number 1 Region: 21-81
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000894
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016V203
Sequence length 131
Comment (tr|A0A016V203|A0A016V203_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC21694.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0018g3483 OC=Ancylostoma.
Sequence
MRWQNLCALILQITSMFALITPGTAVNCQLPRDKGYSCDEPERTMFYFDMRMGVCQPMMH
RGCGGNENKFDSAAKCKEQCIEKKGKAKPSAPASKGAGLVGWFMKYYPTEIVNPFTTEMQ
PSFGPPCSGGV
Download sequence
Identical sequences A0A016V203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]