SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016V6S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016V6S7
Domain Number 1 Region: 15-97
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000106
Family Nuclear receptor ligand-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016V6S7
Sequence length 98
Comment (tr|A0A016V6S7|A0A016V6S7_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC22433.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0017g3347 OC=Ancylostoma.
Sequence
MNRNIIPRKIFRLSAVDGLSLEGQRILAAERDRFNSALFSYCMAVRGISGAPAQYAALIS
LIDTLHHQAKIQKDFHVLLQMNRPSNFLTVSLIEEIME
Download sequence
Identical sequences A0A016V6S7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]