SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016VS45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VS45
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-27
Family Reprolysin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 218-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000131
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 851-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 906-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 984-1041
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 1159-1215
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 627-690
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 8 Region: 689-739
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 9 Region: 1105-1154
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000392
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 10 Region: 743-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 796-856
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 12 Region: 1041-1099
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Weak hits

Sequence:  A0A016VS45
Domain Number - Region: 517-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number - Region: 372-420
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.000283
Family Diacylglycerol kinase-like 0.062
Further Details:      
 
Domain Number - Region: 575-629
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000759
Family TSP-1 type 1 repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016VS45
Sequence length 1255
Comment (tr|A0A016VS45|A0A016VS45_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC30121.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0005g2461 OC=Ancylostoma.
Sequence
MTMKDEFGMRHHINRRAPGKCDTLGLAELGTMCDAGKSCAIIEDNGLSAAFTIAHELGHI
FNIPHDDERKCAQYMQLAKHNFHIMAPTLEYNTHPWSWSTCSSGMLERFLDNNRGQIQCL
FDQPVQRKYYEQLFEDDAPGRKYDVSQQCKFVFGPQSELCPYMPTCRRLWCATYYGSQMG
CRTQHMPWADGTPCDKTGRMQCHRGECVSVGAEHRAKVDGGWGEWRPWETCSRTCGGGVQ
RALRDCDSPKPANGGKYCVGQRERYRSCNVADCPWDTPGFREIQCAEFNNKDVGIHGIPT
RTTWVPKYTAVADNERCKLYCRVAGSAAFYLLKEKVIDGTPCDRNGDDICVDGTCMKAGC
DHRLHSTMTRDKCGICGGDGTTCRVVKGTYNERGSFGYNAVMKIPAGSANIDIRQHGYNN
QKDDDNYLSLRASNGEFLLNGHYQVSVFRQQIPIQDVILEYSGSDNVVERINGTGPIRID
IYVHVLSVGNLLPPDISYEYMTAVDSPSARSPALSNYHWRLGDQWSACDRVCQGTQTQEV
ICVDSSNNRQTSERMCSARRPQVNTRMCNLECITKWMTEDVSHCSAQCGSGEKKQRVYCV
KVEGGRQTITRDEDCDRANRPSERVTCFVDCSGRRWSYSEWSSCSQTCGSTGVSRRSVVC
VDDHNRVVPDHLCVGEAKEGTERECNRFPCPRWVYGHWSECSRSCDGGVRMRHAQCMDAA
DKETHHSRCGPKHDRESCNEHMCTAWSFGQWSTCSVTCGDGIQTREAICVDREGRQLESA
RCNYRERIVQKPCSRPACPSWKVGEWTPCSVSCQDGWSTRRVSCVDSRGEDVRSELCLAG
GLEQPASHRQCNQGPCPFWRTADWSPCSVTCGSGVRRRSAECIYREQVVDQSFCGDSTPP
TTQQSCNLVPCTSWEVSAWSPCSVTCGNGTQTRRAHCTSGPKKELVKDFLCDKSTRPRER
RTCERDACETRVSNLLVLAQPADVPPIRWATGPWSECSAHCGNGTQRRLVKCRDHARDLP
PEYCRDLEKVEDQRPCRIKVCAYWQTGPWMPCPATCGVHVHQTRSVMCIPQNPGETASET
DCNVAERPPSMRSCKLSVCPKGEPPLGRWISGEWTKCSVTCGGGWRRRSVTCDGFICDDT
MKPRMFDECNAVPCPPKSNNTWQISPWTHCSVTCGGGVQRRRVWCEDAVTAQSQDESECR
DRKPKTVRDCELPPCPTSQRVSPAVWQAAPWSPVRRRYRKRAHAHIYHRVSRRVQ
Download sequence
Identical sequences A0A016VS45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]