SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016VSW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VSW2
Domain Number 1 Region: 113-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000116
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 39-109
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  A0A016VSW2
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0288
Family TSP-1 type 1 repeat 0.021
Further Details:      
 
Domain Number - Region: 142-211
Classification Level Classification E-value
Superfamily RING/U-box 0.0353
Family Zf-UBP 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016VSW2
Sequence length 379
Comment (tr|A0A016VSW2|A0A016VSW2_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC30112.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0005g2458 OC=Ancylostoma.
Sequence
MDPCARDEQHRRVYCVNNAGKRAAPRMCSAVQAPPNKRPCDISKCPYEWVPGPWNTCSKT
CGKGTQFRFVECRVKTPNTTKYSEPAVPKEKCEALPMPIEAQECDLNACESEFQWQIGPW
GPCSQTCGQGVRRRKVRCYSRQGVLVSRSKCEQNSPRPRRTQTCFQRNCLPATCQEIRAQ
NIATHSVDGNYTVLLDGFPVTVYCHRMNETIPKSYINLNPATNFAEVYGKRLIYPHTCPF
NGERNDSCQCSDDGDANAGMTHFRKVRVDLLNRKININDMTFADTLHGSYVPYGTAGDCY
SMKDCPQGRFSVDLRGTGLRIVDDLQWEDKGHRTTSRIDRSSNNAVIEGRCGGYCGKCAP
DKYKGLVFSIDQRQLNGGS
Download sequence
Identical sequences A0A016VSW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]