SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016VY61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VY61
Domain Number 1 Region: 812-965,1056-1159
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.55e-37
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 96-190,320-390,499-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.5e-31
Family Ankyrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 666-782
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.6e-19
Family Ankyrin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  A0A016VY61
Domain Number - Region: 1245-1279
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016VY61
Sequence length 1289
Comment (tr|A0A016VY61|A0A016VY61_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC32355.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0003g1529 OC=Ancylostoma.
Sequence
MSYSSRLPQINAHQALPTRYSCSTAESSKHSNTSTNAAESSWSRDCECKRTWVSSQIEGV
SPRFDLEVLPKAGPTRRAVGIGTHARRKRVGTSGRALLAAVCNGDAEAVTKELTARNIRV
CHPVTGCSTLHLAVLGDNPGILSILLKNRSADLNMRDNEGRTALHYAAARCNLDGDPTMY
YMLTEKGAKDDMPGAGAESKMQLNRYSDIPIIDHEGFTPSDIRQNPSLIDLERARCQNKY
PCTMENEWEHLFSSLPESVLTQMIMQGELDLSAAPPMPQYEDIFGRLAQVQAKILGIWDA
ILAEDERTLKQLLFRKDMALCRDSEGRTPLHLAYRRGHQPCIDYLLKLCPEAELIRDKKG
RLPRDYANRAPKLTTTNLAERRGSRTRVLHQSRFQHAHSDSKLMKDKPPPQLNLKETIDE
EITERILNIDFNSSEYDVLEQIQMDGKADQIWATARRNPSNEAMTKYIADFKSLQLRLCS
AMDSVEKNNTKRLRQLIDDDVVKARDPRGMRLLHVAVLKERHEIVEFIATEFPHAINLPD
QAGRAPIHYAAAQPNAIYDTLIDLGADPRITDLEGYSAEAFRQSPDRLRRPASADSSLMI
RSMSTDDEFYDPDAPAEHVVDEWLASGDVAKLEQLVLDGRGHLLKEKTAVNAASKEFLRG
LTVYQSKIDAIHKAVEDGDVRRVKSLIDRQQLALARDSYGMTPLHKALLHGQTNTVRHLL
AKYPQCVNATDHAGRTPLHYAAADPNGEHMIKVLQKAGGDAFIDDKHGHTPFYYRTHGQR
LNVRSMKDNAVMNQLMSGQLSRTLLQDLEEDIYDWIHTGNIGKLEELVLTGYADLLLGRN
HEVEDADSIGFLEVLPQYQAKIQAIHKAVETGNLRAVRLLTDRKKLALCRDSRGLSPLHK
AIVFDRADIAKYLIRNYPHSVNAMDQKKRTPLHYAAAYRDGGYLYKMMRKSGADPNIYDC
NGRPAKYYLKHPGEIDLSAMRLDTKAALKQVLHNRVAPSYLESSIQQWLRDGQLAKLEQL
VLSGCGDLLQNRSGTNPETTTFLENLPEYMSKIEGIHRAIKEGDLEKVKSLMTSKKLAIA
RDRFGCTPLHAAVVHEHTEIVRYIAGHFPSVLNAPDYNKRTSMHYAAAARDGGHYLKILG
KAGADPMAVDNEGRTPDYYRRNAVIDLKMIKERDEEYDMMGEEMMDEGPMLESPDGVESG
TESSVTDSARPQEDDDELDHHRFERMMHGRTDLPTSENGIYLARTVAPVLTKALAEVLLR
RPADPVGFISDYLQKYHRELPRRSNGKLK
Download sequence
Identical sequences A0A016VY61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]