SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016VYL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016VYL4
Domain Number 1 Region: 196-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000196
Family Spermadhesin, CUB domain 0.0083
Further Details:      
 
Weak hits

Sequence:  A0A016VYL4
Domain Number - Region: 89-154
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000234
Family Astacin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016VYL4
Sequence length 316
Comment (tr|A0A016VYL4|A0A016VYL4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC32092.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0003g1393 OC=Ancylostoma.
Sequence
MGLRISTKLFVISIGTAASVRITRNVSEHDAVTIMGHENQDATKNGIDENFSIEKQLSKR
HKRQSEYNAMALLEEFDPNNPPVTPEDHQKQYDKMEENDEAYYGIPYDLGSIMQYAPSNE
NATVIAKDKNYSRTMGSPFVSFTDKLLVNKHYNCSEFCREETAVQCANNGFLDPKDCNTC
VCPKGFGGKSCEKRPDGCGQDVEARTEWQTINLTIYNRDNNGEYMECTVWILADPGKKIE
VQIVGVSTGLDSTGCGKAGVEIKMKNDTRLTGYRFCSDEDNGISLKSNSNLVPVIMYSKV
ATPLDVILNYHSVSST
Download sequence
Identical sequences A0A016VYL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]