SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016W590 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016W590
Domain Number 1 Region: 13-89
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000122
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016W590
Sequence length 109
Comment (tr|A0A016W590|A0A016W590_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC34820.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_1384g3857 OC=Ancylostoma.
Sequence
KSSSSSQKSSKSRRARKEELTREFENCLEQVLTWLLEAEEELSLLDEVDENDLKTVRKQF
KDFENFMASLTESQDTVGRVLHRFEVIEQLVPECRRGVILVKDRAKKRM
Download sequence
Identical sequences A0A016W590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]