SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016WKD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016WKD9
Domain Number 1 Region: 726-777
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000876
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 785-836
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000902
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 844-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000955
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 4 Region: 666-716
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 550-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000994
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 6 Region: 496-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 307-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 210-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000115
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 108-155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 161-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000994
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 361-409
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000706
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 613-657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 13 Region: 408-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016WKD9
Sequence length 920
Comment (tr|A0A016WKD9|A0A016WKD9_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC39493.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0654g1191 OC=Ancylostoma.
Sequence
MVTMCNFKAPKVALWTTIKDHMMQARRTRKDGVMTETRRHLDTYSTQPCRVWCHLIGSEL
IRNKGQFPDGTPCGPNQFCISGTCLRLGCDNRAVVASEDDCPNLNSPTGWSDWSAWSVCS
ESCGSNGRQSRKRSCNFSGARSDCFGEAEEQRPCFPPPPNCNQVSEWGNWSPCRSECGKG
EQSRKRICLTDNCDEVTEERRPCWNPASAACWLEWSNWSDCSQSCDGGHRKRERICPQFD
ECEGAAFEVEQCNTEKIVRTESYWCCEEPTNAEPTVMSHLDPFPNEWSGLRDFSCTAMTG
LLVGAAMRCSSGAWGDWLPCSVSCGIGFQIRERLCDGLLCATASKQARTCNEQPCPASSN
DFEWEDWSEWTECSQTCGEGFQSQERGCRKGSCPSSDSVRQRRCVPGPCPTWEEWSEWTE
CPSCSRYHTRTRSRQCTLHSTGSAASCEGESHMEEACDIWCSSGATSSSHPGIELITGKG
RRRVVAHGGRIVPVENEEWGEWTAWSECSHTCGAGRRTRTRVCVGQHCPFQSRETVKESC
NLQTCLDETSWSSWSPWSDCSVTCGGGGVQARRRRCIRNFLFQCDGSPLETRACSADIEC
LPLSEQYLRTIPSWSPWSPWSSCSCFTMMESRRRFCFVADPAVQGFCTGAIVEQRPCAPT
SCTASPGGWSAWSDWSQCSKDCQGTGHQIRNRMCSEPLPSNRGSYCVGYSFDQRPCTSSH
PCGNRVDGGWSEWSEWSECGGSCANAHRSRTRFCTNPRPSQGGKPCFGNDFELQPCVDDK
CRLSVDGAWGSWSSWSECPNACGFALQSRSRTCDNPPPAFGGKVCRGLAHQTSVCVSELC
NESVDGEWSAWNEWSTCVGNCGLGSRTRVRACVSPSSSHGGVPCFGKSSEIEECQAEGSF
CSRFLHYADLLDLRVLQTLQ
Download sequence
Identical sequences A0A016WKD9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]