SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016WR61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016WR61
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000811
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A016WR61
Sequence length 128
Comment (tr|A0A016WR61|A0A016WR61_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC42140.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0541g3185 OC=Ancylostoma.
Sequence
MFEQVIQIRRRKPLLKMEKDWNRSVCIEDPFDLNHNLGSGVTRKSRQAIPLYIHPDLLWH
SWVSLELGQGCTLSYTYKCPLNHTLKCFARFLTCCCSTSQVLCSSQNMLRSSPSLSFYVM
LLLQSPYY
Download sequence
Identical sequences A0A016WR61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]