SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016WYI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016WYI3
Domain Number 1 Region: 14-51
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000489
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016WYI3
Sequence length 81
Comment (tr|A0A016WYI3|A0A016WYI3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC44337.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0464g1926 OC=Ancylostoma.
Sequence
MTERAVELLQNNKDREERKRKVEVVDGEANERWCFCREVSSGSMICCDAPDVSKNCPLSL
NEFHEFYFSVSTNGSTSNVWD
Download sequence
Identical sequences A0A016WYI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]