SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016XI92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016XI92
Domain Number 1 Region: 18-178
Classification Level Classification E-value
Superfamily Lipocalins 2.06e-32
Family Retinol binding protein-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016XI92
Sequence length 186
Comment (tr|A0A016XI92|A0A016XI92_9BURK) Outer membrane lipoprotein Blc {ECO:0000256|PIRNR:PIRNR036893} KW=Complete proteome OX=1458275 OS=Hylemonella gracilis str. Niagara R. GN=AZ34_07540 OC=Comamonadaceae; Hylemonella.
Sequence
MLQRLKPLLATLGLSGLVGLLAGCQSSPVAPMPTVPQVDLPRFMGDWYVIANIPTFIERG
AHNAVESYRLDTDGTIATTFRFRADAFDGPEKVYNPRGFVLDASNALWGMRFVWPIKADY
RITYLDANYSQTVIARQARDYVWIMARTPSISEADYATLVRHVTELGYDVNRLQKVPQRW
PAAKEQ
Download sequence
Identical sequences A0A016XI92
WP_035606566.1.79976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]