SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017H865 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017H865
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.45e-67
Family TENA/THI-4 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017H865
Sequence length 223
Comment (tr|A0A017H865|A0A017H865_9RHOB) Aminopyrimidine aminohydrolase {ECO:0000256|RuleBase:RU363093} KW=Complete proteome; Reference proteome OX=1122180 OS=Loktanella hongkongensis DSM 17492. GN=Lokhon_00077 OC=Rhodobacteraceae; Loktanella.
Sequence
MSYGRIFPLWRAAAGPHWDAYVDHAFVRGIADGSLPRAAFLHYLVQDYLFLVQFARAWSL
AVTKAETMEEMRHCAATAQALLEDELALHRGICAEAGIDARMLDAAEERPANIAYTRYVL
DAGHAGDFAELLAALVPCVLGYGEIGRRLCTERRDTPYRDWIETYGGADYQALCDKVGAL
LDGAVTRRLGRVPQDAPRWPVLCGRFTTATRLEAGFWQMGLEP
Download sequence
Identical sequences A0A017H865
WP_017929843.1.16665 WP_017929843.1.36416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]