SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017RS10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017RS10
Domain Number 1 Region: 96-188
Classification Level Classification E-value
Superfamily TrpR-like 0.0000000034
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017RS10
Sequence length 193
Comment (tr|A0A017RS10|A0A017RS10_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EYE87249.1} KW=Complete proteome; Reference proteome OX=1403537 OS=Fervidicella metallireducens AeB. GN=Q428_14335 OC=Fervidicella.
Sequence
EIYLYALSAYVHNNPCDIKGYEKCPEKYEFSSLSIYLGLRHDPYELVDDGFIMGMFSKNP
KKARESYMKLVYKCSDKVFKEEVEFLNEGTEYRSERKILIRNIKTKEILEFIASKLRIEK
IKLHTKHCREIVEAKALAVLLMRSLCNLKCSEICRILGNITQSRVSKLSSLGVKLLDDEK
YKNITYEFMEQYA
Download sequence
Identical sequences A0A017RS10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]