SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017RS52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017RS52
Domain Number - Region: 25-92
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.051
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017RS52
Sequence length 125
Comment (tr|A0A017RS52|A0A017RS52_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EYE87299.1} KW=Complete proteome; Reference proteome OX=1403537 OS=Fervidicella metallireducens AeB. GN=Q428_14030 OC=Fervidicella.
Sequence
MNVKEFEEVSKLPGAKRYEYFIKKVADNEELWGLYNDGWAMVADDDGNEMIPFWPRKEFA
EACCLEQWSNYSAEPIDLYEFIDGWLVDMKKDGLSAAIFYTKHDKGIVVKPEKLTEDLNE
ELENY
Download sequence
Identical sequences A0A017RS52
WP_051515176.1.49469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]