SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017RWG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017RWG7
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000222
Family SMI1/KNR4-like 0.013
Further Details:      
 
Weak hits

Sequence:  A0A017RWG7
Domain Number - Region: 189-316
Classification Level Classification E-value
Superfamily TPR-like 0.000443
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017RWG7
Sequence length 356
Comment (tr|A0A017RWG7|A0A017RWG7_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EYE89093.1} KW=Complete proteome; Reference proteome OX=1403537 OS=Fervidicella metallireducens AeB. GN=Q428_04410 OC=Fervidicella.
Sequence
MKRPRFEKFEMKYGYYFPEDFKEFMYFYGGDTQFGSCRFEYPDNIINNLLRIPGKMDFHL
IPFGDVGNGDYYCFYRYGIGKDEYFIGIWLHETYNFVILTSSFKGFLYKCMLDDYLATIV
HGDELSEEEIEICKTESMERCIELSKRYGFDFEKVKKMRSEFDYHKLMVEFDEMALQSLC
FLGKNLIKKRDLNGLDILKYALNVYPFYTAPYYLLGISLLNQGKDFRKYFKEAVKTSVIL
TGYSYWEEDYLEIPEDVHREIALYVDNELKDAETVFEKKLYLGADPYDYSLRLELAREYI
LDKKYHHAMVEYNNAIFCTDSSQIKREILEEAYICAREYGLCFIKGIIEHDLKYIR
Download sequence
Identical sequences A0A017RWG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]