SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017S667 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017S667
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.49e-16
Family AN1-like Zinc finger 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017S667
Sequence length 72
Comment (tr|A0A017S667|A0A017S667_9EURO) Uncharacterized protein {ECO:0000313|EMBL:EYE92351.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_462757 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPPRKPRCSFKECKEQAQRIVGDCSFCSGHFCSKHRMLEAHACSGLEDCKKESHARNADK
LNSERTQVIKGV
Download sequence
Identical sequences A0A017S667 A0A1L9VAF6
jgi|Aspgl1|133756|e_gw1.21.89.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]