SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017SC80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017SC80
Domain Number 1 Region: 36-65,185-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.47e-52
Family G proteins 0.00000697
Further Details:      
 
Domain Number 2 Region: 65-186
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.15e-31
Family Transducin (alpha subunit), insertion domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017SC80
Sequence length 359
Comment (tr|A0A017SC80|A0A017SC80_9EURO) Guanine nucleotide binding protein, alpha subunit {ECO:0000313|EMBL:EYE94244.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_458089 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MGCMSSKTADPVEKEAVQRNARIERVLKGDKKNMDRTIKILLLGAGESGKSTIIKQMRII
HAGGFPEDERHQTRAVIYANLIIAFKVLLDIMNAEHISFEHDSTKPLGQLVDNTDPDVGS
EEAFSDLKIRDAMKTMWNDAGVQKAVARGHEFALHDNLHYYFDSIDRLFMPGWLPDNQDM
LQARLRSTGITETLFELGQMNFRMMDVGGQRSERKKWIHCFEGVQCLLFMVALSGYDQCL
VEDQSANQMHEAMMLFESLANGEWFKRKPIILFLNKIDLFKGKLDMSPVAKHFPDFTGSN
TDFDAAARYFADRFRGINRIPDREIYIHYTNATDTTLLKATMDSVQDMIIQKNLHTLIL
Download sequence
Identical sequences A0A017SC80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]