SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017SCT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A017SCT4
Domain Number - Region: 29-48
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0118
Family Cell wall binding repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A017SCT4
Sequence length 127
Comment (tr|A0A017SCT4|A0A017SCT4_9EURO) 50S ribosomal protein YmL27 {ECO:0000313|EMBL:EYE94449.1} KW=Complete proteome; Reference proteome OX=1388766 OS=Aspergillus ruber CBS 135680. GN=EURHEDRAFT_457594 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MFKPSQPMMARLRLTTKQVNGGYYKGTRSGSMGYFAKNGSYVIDWKKVRTYVVPEDLDQF
KLTPFVTKAMAPTKSRYTDEVEKDGKFVTREKAFEGKDYLELWTSDNGQEVLEMERLDRV
EPEAKSA
Download sequence
Identical sequences A0A017SCT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]