SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017ST91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017ST91
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000746
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017ST91
Sequence length 259
Comment (tr|A0A017ST91|A0A017ST91_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYE99986.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_1859 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MESFVSEARTICERLSRLDLRRVAFGARSHGYTFAPCLTEAEVAEAEQRHGLTLPPPYRA
FITRLGNGGVGPQYGIGPFRVSEEHQSRPFPHTAPFQLTEDTLDDLLPGAARLADCGCGI
EIVLVLNGPAAGQVWLDARYEGGISPLRDAARQPLTFDAWWLHDMRALLARFETIAALMH
EGTLHEEIHAKLEPRELQLHVDEAMASLMDRDPTGRPPLIPSKPWGLICGQVDVLYRAWL
ANRTQKPRPPPSDPADNKP
Download sequence
Identical sequences A0A017ST91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]