SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T1D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017T1D1
Domain Number 1 Region: 45-188
Classification Level Classification E-value
Superfamily OmpH-like 2.22e-23
Family OmpH-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A017T1D1
Sequence length 226
Comment (tr|A0A017T1D1|A0A017T1D1_9DELT) Outer membrane protein H {ECO:0000313|EMBL:EYF02812.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_6547 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MHPAPAPRSTAPLAARLLGRGRTAVLAVALGLGAAALAAPSAAAAQTKTAVIDVRRAMLE
TEEGLRVQASLRKLFDSRQVEIDAKQRSLSEEQDKIEKEDRAGKTPKDQLARRRENLQRQ
AAEFQGAYVEYQREMQRKENELTTPILQKVLGAVRRLASQEGYEMVMEKSAVPYFRADLE
VTDRVIQMCNAGATPEAPAAKPGAAPAKPGAAAPKPAAPAAAPKKP
Download sequence
Identical sequences A0A017T1D1
WP_081865394.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]