SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A017T4C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A017T4C3
Domain Number 1 Region: 19-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-19
Family SMI1/KNR4-like 0.0096
Further Details:      
 
Weak hits

Sequence:  A0A017T4C3
Domain Number - Region: 149-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000275
Family SMI1/KNR4-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A017T4C3
Sequence length 365
Comment (tr|A0A017T4C3|A0A017T4C3_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EYF03862.1} KW=Complete proteome; Reference proteome OX=1192034 OS=Chondromyces apiculatus DSM 436. GN=CAP_5126 OC=Sorangiineae; Polyangiaceae; Chondromyces.
Sequence
MRRVHLLLVEKNQAMLGDFSPEPATAAQIAAMEKQLGRPLPPSYRAFVEEVGRVAWPLEI
FIAQPREADSPLPEFYVPFAHDGGGNYHCFDLRTEPEPWGEKAQEMGIAFWDHEEPEIEE
DAPFPTPFSEWLDEQVDEALWAEVEARREKLAEQLAPYASGTEAPSLEEAQHVGEQLGVE
LPADYLWFSTTVGSIAKPVKIVDATGIASLTGAMRRDHPRVPGGLVAFALERPGRYAAFT
REGRITWVGGPTPAASGAKRGAPPEPEVSFTDYLERVLTMNPSEAATEPAPQVQDPVVTS
RRFLQLLLDKEMIEVEPTFEIEEAAEQLASARVSSRRLMGWLMDRRDIAEVYASDDELMA
LIKTL
Download sequence
Identical sequences A0A017T4C3
WP_044245194.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]